Puerto Rico
Order Entry

 

Polysorbate 40

Supplier: Thermo Scientific Chemicals

Polysorbate 40

Expand 2 Items
 

Span® 40

Supplier: BeanTown Chemical

CAS: 26266-57-9; EC No: 247-568-8; MDL No: MFCD00080946; RTECS: WG2932900 Crystalline; Molecular Formula: C22H42O6; MW: 402.57 Melting Point: 46-47°; Flash point: 113°C (235°F)

Expand 1 Items
 

Polysorbate 40

Supplier: BeanTown Chemical

CAS: 9005-66-7; MDL No: MFCD00165345; RTECS: WG2933000 Liquid Boiling Point: 100°; Flash point: 110°C (230°F) Density (g/mL): 1.083; Refractive Index: 1.470

Expand 2 Items
 

Polysorbate 40 NF

Supplier: Spectrum Chemical Mfg. Corp.

Polysorbate 40, NF is used to solubilize essential oils. 

Expand 3 Items
 

Span® 40

Supplier: TCI America

CAS Number: 26266-57-9
MDL Number: MFCD00080946
Form: Pellet
Color: Pale Yellow
Melting point (°C): 47
Flash Point (°C): 113

Expand 1 Items
 
Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™

Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™

Supplier: G-Biosciences

Many commercial grade detergents contain elevated levels of sulfhydryl oxidizing agents, peroxides, salts and carbonyl compounds

Expand 2 Items
 
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.

Expand 13 Items
 

Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered

Supplier: MilliporeSigma

Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered

Expand 2 Items
 
Expand 2 Items
 

Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.

Expand 1 Items
 

Indium gallium alloy (60:40 w%) ≥99.99% (metals basis)

Supplier: Thermo Scientific Chemicals

Indium Gallium alloy (60:40 w%) ≥99.99% (metals basis)

Expand 2 Items
 

Gold platinum palladium ≥99.9% (metals basis), powder APS <5 micron

Supplier: Thermo Scientific Chemicals

Gold Platinum Palladium ≥99.9% (metals basis), powder APS 5 micron

Expand 2 Items
 
Illuminated Slide Viewing Box, Electron Microscopy Sciences

Illuminated Slide Viewing Box, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences

Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.

Expand 1 Items
 
Fluorescent Viewing Goggles, Noir medicals

Fluorescent Viewing Goggles, Noir medicals

Supplier: NOIR MEDICAL

Necessary protection when operating forensic light source.

Expand 1 Items
 
Expand 26 Items
 
Fluorescent Viewing Goggles

Fluorescent Viewing Goggles

Supplier: NOIR MEDICAL

Necessary Protection When Operating Forensic Light Source

Expand 1 Items
 
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

Supplier: Defibtech

Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.

Expand 3 Items
 
Mighty Scope Dual View Stand, Aven Inc.

Mighty Scope Dual View Stand, Aven Inc.

Supplier: Aven Tools

The Dual View Stand allows users to mount two Mighty Scopes

Expand 1 Items
 

Methylamine 40% (w/w) in aqueous solution

Supplier: Thermo Scientific Chemicals

Methylamine 40% (w/w) in aqueous solution

Expand 3 Items
 

Glyoxal 40% (w/w) in aqueous solution

Supplier: Thermo Scientific Chemicals

Glyoxal 40% (w/w) in aqueous solution

Expand 4 Items
 

Petroleum spirit, 40…60 °C

Supplier: Thermo Scientific Chemicals

Petroleum spirit, 40…60 °C

Expand 2 Items
 
SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP

SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP

Supplier: Bel-Art Products, a Part of SP

Standard 23x30 cm (9x12") three-ring binder comes complete with ten, 22x27 cm (8½x10½") vinyl View-Pack™ Microscope Slide Holder Pages (enough for 160 slides).

Expand 2 Items
 
Dimethylamine 40% in aqueous solution

Dimethylamine 40% in aqueous solution

Supplier: Thermo Scientific Chemicals

Dimethylamine 40% in aqueous solution

Expand 2 Items
 
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIALS US

Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Expand 1 Items
 
Acrylamide solution 40% (w/v)

Acrylamide solution 40% (w/v)

Supplier: RPI

A 40% (w/v) Acrylamide solution.

Expand 3 Items
 
Acrylamide 40% in aqueous solution, Acryl 40™

Acrylamide 40% in aqueous solution, Acryl 40™

Supplier: VWR

VWR offers an extensive line of acrylamide and bis-acrylamide pre-weighed powder blends, pre-mixed stock solutions, and ready-to-use solutions for customized polyacrylamide gel electrophoresis of proteins and PAGE of nucleic acids. Our ultra pure (> 99.9%) acrylamide and bis-acrylamide powders provide the flexibility to prepare solutions having concentrations and ratios for all electrophoresis applications. Liquid blends minimize the handling of neurotoxic acrylamide.

Expand 1 Items
 
Sand 40-100 mesh for analysis

Sand 40-100 mesh for analysis

Supplier: Thermo Scientific Chemicals

Sand 40-100 mesh for analysis

Expand 3 Items
 

Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography

Supplier: Thermo Scientific Chemicals

Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography

Expand 2 Items
 
Sand 40-100 mesh, pure

Sand 40-100 mesh, pure

Supplier: Thermo Scientific Chemicals

Sand 40-100 mesh, pure

Expand 4 Items
 

Human Beta-Amyloid (2-40)

Supplier: Anaspec

This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
 
Recommended for You