Span® 40
Supplier: BeanTown Chemical
CAS: 26266-57-9; EC No: 247-568-8; MDL No: MFCD00080946; RTECS: WG2932900 Crystalline; Molecular Formula: C22H42O6; MW: 402.57 Melting Point: 46-47°; Flash point: 113°C (235°F)
Expand 1 Items
Polysorbate 40
Supplier: BeanTown Chemical
CAS: 9005-66-7; MDL No: MFCD00165345; RTECS: WG2933000 Liquid Boiling Point: 100°; Flash point: 110°C (230°F) Density (g/mL): 1.083; Refractive Index: 1.470
Expand 2 Items
Polysorbate 40 NF
Supplier: Spectrum Chemical Mfg. Corp.
Polysorbate 40, NF is used to solubilize essential oils.
Expand 3 Items
Span® 40
Supplier: TCI America
CAS Number: 26266-57-9
MDL Number: MFCD00080946
Form: Pellet
Color: Pale Yellow
Melting point (°C): 47
Flash Point (°C): 113
Expand 1 Items
Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™
Supplier: G-Biosciences
Many commercial grade detergents contain elevated levels of sulfhydryl oxidizing agents, peroxides, salts and carbonyl compounds
Expand 2 Items
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.
Expand 13 Items
Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered
Supplier: MilliporeSigma
Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered
Expand 2 Items
Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.
Expand 1 Items
Indium gallium alloy (60:40 w%) ≥99.99% (metals basis)
Supplier: Thermo Scientific Chemicals
Indium Gallium alloy (60:40 w%) ≥99.99% (metals basis)
Expand 2 Items
Gold platinum palladium ≥99.9% (metals basis), powder APS <5 micron
Supplier: Thermo Scientific Chemicals
Gold Platinum Palladium ≥99.9% (metals basis), powder APS 5 micron
Expand 2 Items
Illuminated Slide Viewing Box, Electron Microscopy Sciences
Supplier: Electron Microscopy Sciences
Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.
Expand 1 Items
Fluorescent Viewing Goggles, Noir medicals
Supplier: NOIR MEDICAL
Necessary protection when operating forensic light source.
Expand 1 Items
Accessories for AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Lifeline view AED pediatric pad pack
Expand 26 Items
Fluorescent Viewing Goggles
Supplier: NOIR MEDICAL
Necessary Protection When Operating Forensic Light Source
Expand 1 Items
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.
Expand 3 Items
Mighty Scope Dual View Stand, Aven Inc.
Supplier: Aven Tools
The Dual View Stand allows users to mount two Mighty Scopes
Expand 1 Items
Methylamine 40% (w/w) in aqueous solution
Supplier: Thermo Scientific Chemicals
Methylamine 40% (w/w) in aqueous solution
Expand 3 Items
Glyoxal 40% (w/w) in aqueous solution
Supplier: Thermo Scientific Chemicals
Glyoxal 40% (w/w) in aqueous solution
Expand 4 Items
Petroleum spirit, 40…60 °C
Supplier: Thermo Scientific Chemicals
Petroleum spirit, 40…60 °C
Expand 2 Items
SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP
Supplier: Bel-Art Products, a Part of SP
Standard 23x30 cm (9x12") three-ring binder comes complete with ten, 22x27 cm (8½x10½") vinyl View-Pack™ Microscope Slide Holder Pages (enough for 160 slides).
Expand 2 Items
Dimethylamine 40% in aqueous solution
Supplier: Thermo Scientific Chemicals
Dimethylamine 40% in aqueous solution
Expand 2 Items
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™
Supplier: AVANTOR PERFORMANCE MATERIALS US
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™
Expand 1 Items
Acrylamide 40% in aqueous solution, Acryl 40™
Supplier: VWR
VWR offers an extensive line of acrylamide and bis-acrylamide pre-weighed powder blends, pre-mixed stock solutions, and ready-to-use solutions for customized polyacrylamide gel electrophoresis of proteins and PAGE of nucleic acids. Our ultra pure (> 99.9%) acrylamide and bis-acrylamide powders provide the flexibility to prepare solutions having concentrations and ratios for all electrophoresis applications. Liquid blends minimize the handling of neurotoxic acrylamide.
Expand 1 Items
Sand 40-100 mesh for analysis
Supplier: Thermo Scientific Chemicals
Sand 40-100 mesh for analysis
Expand 3 Items
Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography
Supplier: Thermo Scientific Chemicals
Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography
Expand 2 Items
Human Beta-Amyloid (2-40)
Supplier: Anaspec
This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C