Puerto Rico
Order Entry
 

 

AR-42 98%, Ambeed.Inc

Supplier: Ambeed

AR-42 98%, Ambeed.Inc

Expand 6 Items
 

AR-42 ≥98%

Supplier: Aladdin Scientific

AR-42 ≥98%

Expand 6 Items
 
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.

Expand 13 Items
 

6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine 97%

Supplier: Ambeed

6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine, Purity: 97%, CAS Number: 113919-79-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100mg

Expand 2 Items
 
4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid 98%

4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid 98%

Supplier: Ambeed

4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid, Purity: 98%, CAS Number: 1370206-12-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250MG

Expand 2 Items
 
(N-4,N-4,2-Trimethyl)-1,4-benzenediamine

(N-4,N-4,2-Trimethyl)-1,4-benzenediamine

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051351-500MG , MDL Number: MFCD09965937

Expand 2 Items
 
N-4-Benzyl-N-4,2-dimethyl-1,4-benzenediamine

N-4-Benzyl-N-4,2-dimethyl-1,4-benzenediamine

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051372-500MG , MDL Number: MFCD12410390

Expand 2 Items
 
N-4-Cyclohexyl-N-4,2-dimethyl-1,4-benzenediamine

N-4-Cyclohexyl-N-4,2-dimethyl-1,4-benzenediamine

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051370-500MG , MDL Number: MFCD12169085

Expand 2 Items
 

1'H-Spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥95%

Supplier: Matrix Scientific

MF=C12H15N3O MW=217.27 CAS=202826-52-6 MDL=MFCD11049641 5G

Expand 3 Items
 
N-4-Butyl-(N-4,2-dimethyl)-1,4-benzenediamine

N-4-Butyl-(N-4,2-dimethyl)-1,4-benzenediamine

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051358-500MG , MDL Number: MFCD12169089

Expand 2 Items
 

Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.

Expand 1 Items
 

Bismuth tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps

Supplier: Thermo Scientific Chemicals

Bismuth Tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps

Expand 3 Items
 
N-4,2-Dimethyl-N-4-(tetrahydro-2H-pyran-4-ylmethyl)-1,4-benzenediamine

N-4,2-Dimethyl-N-4-(tetrahydro-2H-pyran-4-ylmethyl)-1,4-benzenediamine

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051379-500MG , MDL Number: MFCD13561480

Expand 2 Items
 

1'-Ethyl-6'-methyl-1'H-spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥97%

Supplier: Matrix Scientific

1'-Ethyl-6'-Methyl-1'H-Spiro[Piperidine-4, 2'-Quinazolin]-4'(3'H)-One, MF=C15H21N3O, MW=259.35, CAS=1351398-03-2, 500MG

Expand 2 Items
 

Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate) 95%

Supplier: Ambeed

Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate), Purity: 95%, CAS Number: 1007882-23-6, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 deg C, Size: 5g

Expand 2 Items
 
Fluorescent Viewing Goggles, Noir medicals

Fluorescent Viewing Goggles, Noir medicals

Supplier: NOIR MEDICAL

Necessary protection when operating forensic light source.

Expand 1 Items
 
Expand 26 Items
 

(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%

Supplier: Ambeed

(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%

Expand 4 Items
 
Illuminated Slide Viewing Box, Electron Microscopy Sciences

Illuminated Slide Viewing Box, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences

Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.

Expand 1 Items
 

Human Beta-Amyloid (9-42)

Supplier: Anaspec

Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
 

(Gly²²)-beta-Amyloid (1-42)

Supplier: Bachem Americas

The arctic mutant of amyloid β-protein 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.

Expand 2 Items
 

beta-Amyloid (42-1)

Supplier: Bachem Americas

Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.

Expand 2 Items
 
Fluorescent Viewing Goggles

Fluorescent Viewing Goggles

Supplier: NOIR MEDICAL

Necessary Protection When Operating Forensic Light Source

Expand 1 Items
 
Mighty Scope Dual View Stand, Aven Inc.

Mighty Scope Dual View Stand, Aven Inc.

Supplier: Aven Tools

The Dual View Stand allows users to mount two Mighty Scopes

Expand 1 Items
 

beta-Amyloid (1-42)

Supplier: Bachem Americas

Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer's disease and late Down's syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of H-1368 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42 peptide. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.

Expand 4 Items
 
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

Supplier: Defibtech

Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.

Expand 3 Items
 

Human Beta-Amyloid (4-42)

Supplier: Anaspec

Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
 

beta-Amyloid (42-1)

Supplier: Thermo Scientific Chemicals

b (42-1)

Expand 1 Items
 

beta-Amyloid (1-42)

Supplier: Thermo Scientific Chemicals

b (1-42), hydrochloride

Expand 2 Items
 

beta-Amyloid (33-42) Trifluoroacetate

Supplier: Bachem Americas

GLMVGGVVIA, a partial sequence of β-amyloid protein which is used for raising antibodies against Aβ 1-42. Li et al. studied the aggregation behavior of this and other Aβ 1-42 C-terminal fragments.

Expand 1 Items
 
Recommended for You