Puerto Rico
Order Entry

17755 Results for: "Methyl-2-acetyl-3-(dimethylamino)acrylate&pageNo=40"

Sort By
3-Cyanoumbelliferone ≥95%

3-Cyanoumbelliferone ≥95%

Supplier: AAT Bioquest

3-Cyano-7-hydroxycoumarin is used as a calibration standard for 3-cyano-7-hydroxycoumarin-based enzyme substrates.

Expand 1 Items
Loading...
KIMAX® Volumetric Flasks with [ST] Glass Stopper, Red Stripe, Class A, Kimble Chase

KIMAX® Volumetric Flasks with [ST] Glass Stopper, Red Stripe, Class A, Kimble Chase

Supplier: DWK Life Sciences (KIMBLE)

Calibrated to contain

Expand 1 Items
Loading...
pH Reference Standard Buffers, VWR Chemicals BDH®

pH Reference Standard Buffers, VWR Chemicals BDH®

Supplier: BDH

BDH pH buffers are available as either colorless or colored solutions.

Expand 1 Items
Loading...

Polysorbate 40

Supplier: Thermo Scientific Chemicals

Polysorbate 40

Expand 2 Items
Loading...

Polysorbate 40

Supplier: BeanTown Chemical

CAS: 9005-66-7; MDL No: MFCD00165345; RTECS: WG2933000 Liquid Boiling Point: 100°; Flash point: 110°C (230°F) Density (g/mL): 1.083; Refractive Index: 1.470

Expand 2 Items
Loading...

Span® 40

Supplier: BeanTown Chemical

CAS: 26266-57-9; EC No: 247-568-8; MDL No: MFCD00080946; RTECS: WG2932900 Crystalline; Molecular Formula: C22H42O6; MW: 402.57 Melting Point: 46-47°; Flash point: 113°C (235°F)

Expand 1 Items
Loading...

Polysorbate 40 NF

Supplier: Spectrum Chemical Mfg. Corp.

Polysorbate 40, NF is used to solubilize essential oils. 

Expand 3 Items
Loading...

Span® 40

Supplier: TCI America

CAS Number: 26266-57-9
MDL Number: MFCD00080946
Form: Pellet
Color: Pale Yellow
Melting point (°C): 47
Flash Point (°C): 113

Expand 1 Items
Loading...
Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™

Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™

Supplier: G-Biosciences

Many commercial grade detergents contain elevated levels of sulfhydryl oxidizing agents, peroxides, salts and carbonyl compounds

Expand 2 Items
Loading...

Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered

Supplier: MilliporeSigma

Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered

Expand 2 Items
Loading...
Expand 2 Items
Loading...

Indium gallium alloy (60:40 w%) ≥99.99% (metals basis)

Supplier: Thermo Scientific Chemicals

Indium Gallium alloy (60:40 w%) ≥99.99% (metals basis)

Expand 2 Items
Loading...

Gold platinum palladium ≥99.9% (metals basis), powder APS <5 micron

Supplier: Thermo Scientific Chemicals

Gold Platinum Palladium ≥99.9% (metals basis), powder APS 5 micron

Expand 2 Items
Loading...

Methylamine 40% (w/w) in aqueous solution

Supplier: Thermo Scientific Chemicals

Methylamine 40% (w/w) in aqueous solution

Expand 3 Items
Loading...

Glyoxal 40% (w/w) in aqueous solution

Supplier: Thermo Scientific Chemicals

Glyoxal 40% (w/w) in aqueous solution

Expand 4 Items
Loading...

Petroleum spirit, 40…60 °C

Supplier: Thermo Scientific Chemicals

Petroleum spirit, 40…60 °C

Expand 2 Items
Loading...
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIALS US

Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™

Expand 1 Items
Loading...
Dimethylamine 40% in aqueous solution

Dimethylamine 40% in aqueous solution

Supplier: Thermo Scientific Chemicals

Dimethylamine 40% in aqueous solution

Expand 2 Items
Loading...
Acrylamide solution 40% (w/v)

Acrylamide solution 40% (w/v)

Supplier: RPI

A 40% (w/v) Acrylamide solution.

Expand 3 Items
Loading...
Acrylamide 40% in aqueous solution, Acryl 40™

Acrylamide 40% in aqueous solution, Acryl 40™

Supplier: VWR

VWR offers an extensive line of acrylamide and bis-acrylamide pre-weighed powder blends, pre-mixed stock solutions, and ready-to-use solutions for customized polyacrylamide gel electrophoresis of proteins and PAGE of nucleic acids. Our ultra pure (> 99.9%) acrylamide and bis-acrylamide powders provide the flexibility to prepare solutions having concentrations and ratios for all electrophoresis applications. Liquid blends minimize the handling of neurotoxic acrylamide.

Expand 1 Items
Loading...
Sand 40-100 mesh for analysis

Sand 40-100 mesh for analysis

Supplier: Thermo Scientific Chemicals

Sand 40-100 mesh for analysis

Expand 3 Items
Loading...

Manganese 99+%, powder -40 mesh

Supplier: Thermo Scientific Chemicals

Manganese 99+%, powder -40 mesh

Expand 2 Items
Loading...

Charcoal activated -20+40 mesh

Supplier: Thermo Scientific Chemicals

Charcoal activated -20+40 mesh

Expand 3 Items
Loading...

Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography

Supplier: Thermo Scientific Chemicals

Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography

Expand 2 Items
Loading...

Castor oil, hydrogenated, ethoxylated 40, hydrogenated

Supplier: Spectrum Chemical Mfg. Corp.

Polyethylene Glycol 40 Castor Oil, Hydrogenated is a polyether compound that is used in a wide variety of fields including pharmaceutical manufacturing as an excipient and active ingredient. Due to its low toxicity it can be used as a lubricating coating for various surfaces in aqueous and non-aqueous environments, a reagent in biochemistry to create very high osmotic pressures, a polar stationary phase for gas chromatography and as a binder.

Expand 3 Items
Loading...

beta-Amyloid (1-40)

Supplier: Thermo Scientific Chemicals

b (1-40)

Expand 2 Items
Loading...
Sand 40-100 mesh, pure

Sand 40-100 mesh, pure

Supplier: Thermo Scientific Chemicals

Sand 40-100 mesh, pure

Expand 4 Items
Loading...

Benzyltrimethylammonium hydroxide 40% (w/w) in aqueous solution

Supplier: Thermo Scientific Chemicals

Benzyltrimethylammonium hydroxide, 40% w/w aq. soln.

Expand 2 Items
Loading...
Human Interleukin-40 (IL-40) ELISA Kit, AFG Bioscience

Human Interleukin-40 (IL-40) ELISA Kit, AFG Bioscience

Supplier: AFG Bioscience

Human Interleukin-40 (IL-40) ELISA Kit, AFG Bioscience

Expand 1 Items
Loading...

Human Beta-Amyloid (2-40)

Supplier: Anaspec

This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...
Sort By
Recommended for You