3-Cyanoumbelliferone ≥95%
Supplier: AAT Bioquest
3-Cyano-7-hydroxycoumarin is used as a calibration standard for 3-cyano-7-hydroxycoumarin-based enzyme substrates.
Expand 1 Items
KIMAX® Volumetric Flasks with [ST] Glass Stopper, Red Stripe, Class A, Kimble Chase
Supplier: DWK Life Sciences (KIMBLE)
Calibrated to contain
Expand 1 Items
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
BDH pH buffers are available as either colorless or colored solutions.
Expand 1 Items
Span® 40
Supplier: BeanTown Chemical
CAS: 26266-57-9; EC No: 247-568-8; MDL No: MFCD00080946; RTECS: WG2932900 Crystalline; Molecular Formula: C22H42O6; MW: 402.57 Melting Point: 46-47°; Flash point: 113°C (235°F)
Expand 1 Items
Polysorbate 40
Supplier: BeanTown Chemical
CAS: 9005-66-7; MDL No: MFCD00165345; RTECS: WG2933000 Liquid Boiling Point: 100°; Flash point: 110°C (230°F) Density (g/mL): 1.083; Refractive Index: 1.470
Expand 2 Items
Polysorbate 40 NF
Supplier: Spectrum Chemical Mfg. Corp.
Polysorbate 40, NF is used to solubilize essential oils.
Expand 3 Items
Span® 40
Supplier: TCI America
CAS Number: 26266-57-9
MDL Number: MFCD00080946
Form: Pellet
Color: Pale Yellow
Melting point (°C): 47
Flash Point (°C): 113
Expand 1 Items
Nonidet® P 40 Substitute (NP-40) 10% in aqueous solution, 2D-Detergent™
Supplier: G-Biosciences
Many commercial grade detergents contain elevated levels of sulfhydryl oxidizing agents, peroxides, salts and carbonyl compounds
Expand 2 Items
Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered
Supplier: MilliporeSigma
Nonidet® P 40 Substitute (NP-40) solution 10%, PROTEIN GRADE® detergent, sterile-filtered
Expand 2 Items
Indium gallium alloy (60:40 w%) ≥99.99% (metals basis)
Supplier: Thermo Scientific Chemicals
Indium Gallium alloy (60:40 w%) ≥99.99% (metals basis)
Expand 2 Items
Gold platinum palladium ≥99.9% (metals basis), powder APS <5 micron
Supplier: Thermo Scientific Chemicals
Gold Platinum Palladium ≥99.9% (metals basis), powder APS 5 micron
Expand 2 Items
Methylamine 40% (w/w) in aqueous solution
Supplier: Thermo Scientific Chemicals
Methylamine 40% (w/w) in aqueous solution
Expand 3 Items
Glyoxal 40% (w/w) in aqueous solution
Supplier: Thermo Scientific Chemicals
Glyoxal 40% (w/w) in aqueous solution
Expand 4 Items
Petroleum spirit, 40…60 °C
Supplier: Thermo Scientific Chemicals
Petroleum spirit, 40…60 °C
Expand 2 Items
Dimethylamine 40% in aqueous solution
Supplier: Thermo Scientific Chemicals
Dimethylamine 40% in aqueous solution
Expand 2 Items
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™
Supplier: AVANTOR PERFORMANCE MATERIALS US
Tetrabutylammonium hydroxide 40% in water, Macron Fine Chemicals™
Expand 1 Items
Acrylamide 40% in aqueous solution, Acryl 40™
Supplier: VWR
VWR offers an extensive line of acrylamide and bis-acrylamide pre-weighed powder blends, pre-mixed stock solutions, and ready-to-use solutions for customized polyacrylamide gel electrophoresis of proteins and PAGE of nucleic acids. Our ultra pure (> 99.9%) acrylamide and bis-acrylamide powders provide the flexibility to prepare solutions having concentrations and ratios for all electrophoresis applications. Liquid blends minimize the handling of neurotoxic acrylamide.
Expand 1 Items
Sand 40-100 mesh for analysis
Supplier: Thermo Scientific Chemicals
Sand 40-100 mesh for analysis
Expand 3 Items
Manganese 99+%, powder -40 mesh
Supplier: Thermo Scientific Chemicals
Manganese 99+%, powder -40 mesh
Expand 2 Items
Charcoal activated -20+40 mesh
Supplier: Thermo Scientific Chemicals
Charcoal activated -20+40 mesh
Expand 3 Items
Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography
Supplier: Thermo Scientific Chemicals
Silica gel, Pore size: 40 Å 40-63 µm, Ultrapure for column chromatography
Expand 2 Items
Benzyltrimethylammonium hydroxide 40% (w/w) in aqueous solution
Supplier: Thermo Scientific Chemicals
Benzyltrimethylammonium hydroxide, 40% w/w aq. soln.
Expand 2 Items
Human Beta-Amyloid (2-40)
Supplier: Anaspec
This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Petroleum spirit, 40…60 °C ACS
Supplier: Thermo Scientific Chemicals
Petroleum spirit, 40…60 °C ACS
Expand 4 Items
Human Interleukin-40 (IL-40) ELISA Kit, AFG Bioscience
Supplier: AFG Bioscience
Human Interleukin-40 (IL-40) ELISA Kit, AFG Bioscience