10489 Results for: "Dipotassium+tetrachloropalladate&pageNo=42&view=easy"
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.
Expand 13 Items
6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine 97%
Supplier: Ambeed
6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine, Purity: 97%, CAS Number: 113919-79-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100mg
Expand 2 Items
(N-4,N-4,2-Trimethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051351-500MG , MDL Number: MFCD09965937
Expand 2 Items
4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid 98%
Supplier: Ambeed
4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid, Purity: 98%, CAS Number: 1370206-12-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250MG
Expand 2 Items
1'H-Spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥95%
Supplier: Matrix Scientific
MF=C12H15N3O MW=217.27 CAS=202826-52-6 MDL=MFCD11049641 5G
Expand 3 Items
N-4-Cyclohexyl-N-4,2-dimethyl-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051370-500MG , MDL Number: MFCD12169085
Expand 2 Items
N-4-Benzyl-N-4,2-dimethyl-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051372-500MG , MDL Number: MFCD12410390
Expand 2 Items
Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.
Expand 1 Items
N-4-Butyl-(N-4,2-dimethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051358-500MG , MDL Number: MFCD12169089
Expand 2 Items
Bismuth tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps
Supplier: Thermo Scientific Chemicals
Bismuth Tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps
Expand 3 Items
N-4,2-Dimethyl-N-4-(tetrahydro-2H-pyran-4-ylmethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051379-500MG , MDL Number: MFCD13561480
Expand 2 Items
1'-Ethyl-6'-methyl-1'H-spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥97%
Supplier: Matrix Scientific
1'-Ethyl-6'-Methyl-1'H-Spiro[Piperidine-4, 2'-Quinazolin]-4'(3'H)-One, MF=C15H21N3O, MW=259.35, CAS=1351398-03-2, 500MG
Expand 2 Items
Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate) 95%
Supplier: Ambeed
Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate), Purity: 95%, CAS Number: 1007882-23-6, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 deg C, Size: 5g
Expand 2 Items
Fluorescent Viewing Goggles, Noir medicals
Supplier: NOIR MEDICAL
Necessary protection when operating forensic light source.
Expand 1 Items
Accessories for AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Lifeline view AED pediatric pad pack
Expand 26 Items
Illuminated Slide Viewing Box, Electron Microscopy Sciences
Supplier: Electron Microscopy Sciences
Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.
Expand 1 Items
(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%
Supplier: Ambeed
(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%
Expand 4 Items
(Gly²²)-beta-Amyloid (1-42)
Supplier: Bachem Americas
The arctic mutant of amyloid β-protein 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.
Expand 2 Items
beta-Amyloid (42-1)
Supplier: Bachem Americas
Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.
Expand 2 Items
Human Beta-Amyloid (9-42)
Supplier: Anaspec
Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Fluorescent Viewing Goggles
Supplier: NOIR MEDICAL
Necessary Protection When Operating Forensic Light Source
Expand 1 Items
Mighty Scope Dual View Stand, Aven Inc.
Supplier: Aven Tools
The Dual View Stand allows users to mount two Mighty Scopes
Expand 1 Items
beta-Amyloid (1-42)
Supplier: Bachem Americas
Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer's disease and late Down's syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of H-1368 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42 peptide. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.
Expand 4 Items
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.
Expand 3 Items
beta-Amyloid (33-42) Trifluoroacetate
Supplier: Bachem Americas
GLMVGGVVIA, a partial sequence of β-amyloid protein which is used for raising antibodies against Aβ 1-42. Li et al. studied the aggregation behavior of this and other Aβ 1-42 C-terminal fragments.
Expand 1 Items
beta-Amyloid (1-42)
Supplier: Thermo Scientific Chemicals
b (1-42), hydrochloride
Expand 2 Items
(Met(O)³⁵)-beta-Amyloid (1-42)
Supplier: Bachem Americas
(Met(O)³⁵)-Amyloid β-protein (1-42) (H-5888), in contrast to Aβ 1-42 (H-1368), has been shown to be non-toxic to 9-11 day-old rat embryonic hippocampal neuronal cultures and not to produce any protein oxidation. It has also been demonstrated that fibril formation is not affected by Met(O)³⁵. For the Nle analog see H-7308.