10495 Results for: "Cuvettes&pageNo=42&view=list"

Supplier: Ambeed

AR-42 98%, Ambeed.Inc

Supplier: Aladdin Scientific

AR-42 ≥98%

Supplier: Analytik Jena US

UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.

Supplier: Ambeed

6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine, Purity: 97%, CAS Number: 113919-79-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100mg

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051351-500MG , MDL Number: MFCD09965937

Supplier: Ambeed

4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid, Purity: 98%, CAS Number: 1370206-12-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250MG

Supplier: Matrix Scientific

MF=C12H15N3O MW=217.27 CAS=202826-52-6 MDL=MFCD11049641 5G

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051372-500MG , MDL Number: MFCD12410390

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051370-500MG , MDL Number: MFCD12169085

Supplier: Analytik Jena US

Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051358-500MG , MDL Number: MFCD12169089

Supplier: Thermo Scientific Chemicals

Bismuth Tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051379-500MG , MDL Number: MFCD13561480

Supplier: Matrix Scientific

1'-Ethyl-6'-Methyl-1'H-Spiro[Piperidine-4, 2'-Quinazolin]-4'(3'H)-One, MF=C15H21N3O, MW=259.35, CAS=1351398-03-2, 500MG

Supplier: Ambeed

Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate), Purity: 95%, CAS Number: 1007882-23-6, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 deg C, Size: 5g

Supplier: NOIR MEDICAL

Necessary protection when operating forensic light source.

Supplier: Defibtech

Lifeline view AED pediatric pad pack

Supplier: Electron Microscopy Sciences

Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.

Supplier: Ambeed

(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%

Supplier: Anaspec

Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: NOIR MEDICAL

Necessary Protection When Operating Forensic Light Source

Supplier: Bachem Americas

The arctic mutant of amyloid β-protein 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.

Supplier: Bachem Americas

Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.

Supplier: Aven Tools

The Dual View Stand allows users to mount two Mighty Scopes

Supplier: Defibtech

Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.

Supplier: Bachem Americas

Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer's disease and late Down's syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of H-1368 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42 peptide. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.

Supplier: Thermo Scientific Chemicals

b (1-42), hydrochloride

Supplier: Thermo Scientific Chemicals

b (42-1)

Supplier: Bachem Americas

(Met(O)³⁵)-Amyloid β-protein (1-42) (H-5888), in contrast to Aβ 1-42 (H-1368), has been shown to be non-toxic to 9-11 day-old rat embryonic hippocampal neuronal cultures and not to produce any protein oxidation. It has also been demonstrated that fibril formation is not affected by Met(O)³⁵. For the Nle analog see H-7308.

Supplier: Anaspec

This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C