6-Chloro-8-fluoro-umbelliferone fluorescence reference standard
Supplier: AAT Bioquest
This compound is used as a calibration standard for CF-MU-based enzyme substrates.
Expand 1 Items
KIMAX® Volumetric Flasks with [ST] Glass Stopper, Red Stripe, Class A, Kimble Chase
Supplier: DWK Life Sciences (KIMBLE)
Calibrated to contain
Expand 1 Items
6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine 97%
Supplier: Ambeed
6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine, Purity: 97%, CAS Number: 113919-79-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100mg
Expand 2 Items
(N-4,N-4,2-Trimethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051351-500MG , MDL Number: MFCD09965937
Expand 2 Items
4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid 98%
Supplier: Ambeed
4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid, Purity: 98%, CAS Number: 1370206-12-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 1G
Expand 2 Items
N-4-Benzyl-N-4,2-dimethyl-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051372-500MG , MDL Number: MFCD12410390
Expand 2 Items
1'H-Spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥95%
Supplier: Matrix Scientific
MF=C12H15N3O MW=217.27 CAS=202826-52-6 MDL=MFCD11049641 1G
Expand 3 Items
N-4-Cyclohexyl-N-4,2-dimethyl-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051370-500MG , MDL Number: MFCD12169085
Expand 2 Items
N-4-Butyl-(N-4,2-dimethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051358-500MG , MDL Number: MFCD12169089
Expand 2 Items
Bismuth tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps
Supplier: Thermo Scientific Chemicals
Bismuth Tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps
Expand 3 Items
N-4,2-Dimethyl-N-4-(tetrahydro-2H-pyran-4-ylmethyl)-1,4-benzenediamine
Supplier: Matrix Scientific
Matrix Scientific Part Number: 051379-500MG , MDL Number: MFCD13561480
Expand 2 Items
1'-Ethyl-6'-methyl-1'H-spiro[piperidine-4,2'-quinazolin]-4'(3'H)-one ≥97%
Supplier: Matrix Scientific
1'-Ethyl-6'-Methyl-1'H-Spiro[Piperidine-4, 2'-Quinazolin]-4'(3'H)-One, MF=C15H21N3O, MW=259.35, CAS=1351398-03-2, 500MG
Expand 2 Items
Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate) 95%
Supplier: Ambeed
Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate), Purity: 95%, CAS Number: 1007882-23-6, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 deg C, Size: 5g
Expand 2 Items
Human Beta-Amyloid (9-42)
Supplier: Anaspec
Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%
Supplier: Ambeed
(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%
Expand 4 Items
(Gly²²)-beta-Amyloid (1-42)
Supplier: Bachem Americas
The arctic mutant of amyloid β-protein 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.
Expand 2 Items
beta-Amyloid (42-1)
Supplier: Bachem Americas
Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.
Expand 2 Items
beta-Amyloid (1-42)
Supplier: Bachem Americas
Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer's disease and late Down's syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of H-1368 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42 peptide. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.
Expand 4 Items
beta-Amyloid (33-42) Trifluoroacetate
Supplier: Bachem Americas
GLMVGGVVIA, a partial sequence of β-amyloid protein which is used for raising antibodies against Aβ 1-42. Li et al. studied the aggregation behavior of this and other Aβ 1-42 C-terminal fragments.
Expand 1 Items
Anti-protein 4.2 Rabbit Polyclonal Antibody (Alexa Fluor® 750)
Supplier: Bioss
Protein 4.2; protein4.2; EPB42; EPB42_HUMAN; Erythrocyte membrane protein band 4.2; Erythrocyte protein 4.2; Erythrocyte surface protein band 4.2; MGC116735; P4.2; PA; SPH5.
Expand 1 Items
Human Beta-Amyloid (3-42)
Supplier: Anaspec
This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 2 Items
(Met(O)³⁵)-beta-Amyloid (1-42)
Supplier: Bachem Americas
(Met(O)³⁵)-Amyloid β-protein (1-42) (H-5888), in contrast to Aβ 1-42 (H-1368), has been shown to be non-toxic to 9-11 day-old rat embryonic hippocampal neuronal cultures and not to produce any protein oxidation. It has also been demonstrated that fibril formation is not affected by Met(O)³⁵. For the Nle analog see H-7308.
Expand 1 Items
Human Beta-Amyloid (4-42)
Supplier: Anaspec
Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Human GIP (3-42)
Supplier: Anaspec
This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
ent-beta-Amyloid (1-42)
Supplier: Bachem Americas
All-D Aβ (1-42) exhibits similar properites as the all-L Aβ. The peptide forms ion channels in lipid bilayers.