8308 Results for: "Amberlite\\u00AE+IR-120+(H)&pageNo=52&view=list"
Acid red 52
Supplier: Spectrum Chemical Mfg. Corp.
Acid Red 52 is a fluorescent rhodamine dye also known as Sulforhodamine B and Kiton Red, and used as a polar tracer.
Expand 1 Items
Acid red 52
Supplier: Thermo Scientific Chemicals
Fluorescent dye which uses laser-induced fluorescence for quantification of cellular proteins
Expand 2 Items
Acid red 52
Supplier: TCI America
CAS Number: 3520-42-1
MDL Number: MFCD00010180
Molecular Formula: C27H30N2O7S2
Molecular Weight: 580.65
Form: Crystal
Color: Deep Red
Expand 1 Items
Acid red 52 ≥95%
Supplier: AAT Bioquest
Sulforhodamine B, also known as Kiton Red, is primarily used as a polar tracer.
Expand 1 Items
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.
Expand 13 Items
Acid red 52
Supplier: TCI America
CAS Number: 3520-42-1
MDL Number: MFCD00010180
Molecular Formula: C27H30N2O7S2
Molecular Weight: 580.65
Form: Powder
Color: Purple
Expand 1 Items
Acid red 52, powder C.I. 45100
Supplier: MP Biomedicals
Soluble in water (20 mg/mL) or ethanol (5 mg/mL). Creates a bluish-red solution with a yellow fluorescence.
Expand 3 Items
Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena
Supplier: Analytik Jena US
Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.
Expand 1 Items
Indium tin alloy (52:48 w%), eutectic ≥99.99% (metals basis), ingot
Supplier: Thermo Scientific Chemicals
MDL: MFCD00144477
Expand 2 Items
Fluorescent Viewing Goggles, Noir medicals
Supplier: NOIR MEDICAL
Necessary protection when operating forensic light source.
Expand 1 Items
Accessories for AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Lifeline view AED pediatric pad pack
Expand 26 Items
PCB No. 52, Dr. Ehrenstorfer, LGC Standards
Supplier: LGC Standards
Organic Standard, PCB No. 52
Expand 1 Items
Illuminated Slide Viewing Box, Electron Microscopy Sciences
Supplier: Electron Microscopy Sciences
Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.
Expand 1 Items
Acid Red 52, Dr. Ehrenstorfer, LGC Standards
Supplier: LGC Standards
Organic Standard, Acid Red 52
Expand 1 Items
Fluorescent Viewing Goggles
Supplier: NOIR MEDICAL
Necessary Protection When Operating Forensic Light Source
Expand 1 Items
Human Adrenomedullin (1-52)
Supplier: Anaspec
Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human Adrenomedullin (1-52)
Supplier: Thermo Scientific Chemicals
Adrenomedullin (1-52), human
Expand 1 Items
Mighty Scope Dual View Stand, Aven Inc.
Supplier: Aven Tools
The Dual View Stand allows users to mount two Mighty Scopes
Expand 1 Items
Buffer, Sodium Acetate Buffer Solution pH 5,2 (3 mol/L), ROCK
Supplier: Rockland Immunochemical
3.0 M Sodium Acetate, pH 5.2
Expand 1 Items
E alpha (52–68)
Supplier: Anaspec
This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech
Supplier: Defibtech
Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.
Expand 3 Items
Human Adrenomedullin (22-52)
Supplier: Anaspec
AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Anti-p-CK Antibody [clone: CAM 5.2]
Supplier: Diagnostic Biosystems
Anti-Cytokeratin (CAM 5.2) reagent has a primary reactivity with human keratin proteins that correspond to Moll’s peptides #7 and #8, Mr 48 and 52 kilodaltons (kd), respectively. Cytokeratin 7 and 8 are present on secretory epithelia of normal human tissue but not onstratified squamous epithelium. Anti-Cytokeratin (CAM 5.2) stains most epithelial-derived tissue, including liver, renal tubular epithelium, and hepatocellular and renal cell carcinomas. Anti-Cytokeratin (CAM 5.2) might not react with some squamous cell carcinomas.
Expand 3 Items
3M Sodium Acetate, pH 5.2 Solution, Teknova
Supplier: Teknova
pH adjusted to 5.2 with Glacial Acetic acid. Size: 250mL.
Expand 1 Items
Human Adrenomedullin (13-52)
Supplier: Thermo Scientific Chemicals
Adrenomedullin (13-52), human
Expand 1 Items
SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP
Supplier: Bel-Art Products, a Part of SP
Standard 23x30 cm (9x12") three-ring binder comes complete with ten, 22x27 cm (8½x10½") vinyl View-Pack™ Microscope Slide Holder Pages (enough for 160 slides).
Expand 2 Items
Pharmaceutical Standards, Fingolimod Impurity 52
Supplier: TLC Standards
Pharmaceutical Standards, Fingolimod Impurity 52
Expand 3 Items
Pharmaceutical Standards, Rivaroxaban Impurity 52
Supplier: TLC Standards
Pharmaceutical Standards, Rivaroxaban Impurity 52
Expand 3 Items
Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)
Supplier: Creative Biomart
Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)