Puerto Rico
Order Entry

8308 Results for: "Amberlite\\u00AE+IR-120+(H)&pageNo=52&view=list"

Sort By

Acid red 52

Supplier: Spectrum Chemical Mfg. Corp.

Acid Red 52 is a fluorescent rhodamine dye also known as Sulforhodamine B and Kiton Red, and used as a polar tracer.

Expand 1 Items
Loading...

Acid red 52

Supplier: Thermo Scientific Chemicals

Fluorescent dye which uses laser-induced fluorescence for quantification of cellular proteins

Expand 2 Items
Loading...

Acid red 52 95%

Supplier: Ambeed

Acid red 52 95%

Expand 6 Items
Loading...

Acid red 52

Supplier: TCI America

CAS Number: 3520-42-1
MDL Number: MFCD00010180
Molecular Formula: C27H30N2O7S2
Molecular Weight: 580.65
Form: Crystal
Color: Deep Red

Expand 1 Items
Loading...
Acid red 52 ≥95%

Acid red 52 ≥95%

Supplier: AAT Bioquest

Sulforhodamine B, also known as Kiton Red, is primarily used as a polar tracer.

Expand 1 Items
Loading...
UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

UVP Chromato-Vue Viewing Cabinets provide a darkroom environment for viewing materials, non-destructive testing (NDT), inspection, quality control and chromatography applications. All models include an integrated, contrast control filter to protect the eyes from harmful shortwave radiation and blocks the 'blue haze' associated with longwave UV. Viewport has adequate space for eyeglasses. A lightweight access curtain allows for easy entry and blocks out external light. A variety of cabinets are available to choose from.

Expand 13 Items
Loading...

Acid red 52

Supplier: TCI America

CAS Number: 3520-42-1
MDL Number: MFCD00010180
Molecular Formula: C27H30N2O7S2
Molecular Weight: 580.65
Form: Powder
Color: Purple

Expand 1 Items
Loading...

Acid red 52, powder C.I. 45100

Supplier: MP Biomedicals

Soluble in water (20 mg/mL) or ethanol (5 mg/mL). Creates a bluish-red solution with a yellow fluorescence.

Expand 3 Items
Loading...

Accessories for UVP Chromato-Vue® Viewing Cabinets, Analytik Jena

Supplier: Analytik Jena US

Provides 8W and a wavelength of 254nm UV (shortwave). Replacement part for use with Transilluminator Benchtop Models. Also for use for Chromato-Vue* UV Illumination Cabinet, Model C-65. Short-wave.

Expand 1 Items
Loading...

Indium tin alloy (52:48 w%), eutectic ≥99.99% (metals basis), ingot

Supplier: Thermo Scientific Chemicals

MDL: MFCD00144477

Expand 2 Items
Loading...
Fluorescent Viewing Goggles, Noir medicals

Fluorescent Viewing Goggles, Noir medicals

Supplier: NOIR MEDICAL

Necessary protection when operating forensic light source.

Expand 1 Items
Loading...
Expand 26 Items
Loading...
PCB No. 52, Dr. Ehrenstorfer, LGC Standards

PCB No. 52, Dr. Ehrenstorfer, LGC Standards

Supplier: LGC Standards

Organic Standard, PCB No. 52

Expand 1 Items
Loading...
Illuminated Slide Viewing Box, Electron Microscopy Sciences

Illuminated Slide Viewing Box, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences

Sorting and viewing 2×2" slides easily and quickly is made possible with this slide sorter unit. All metal frame, its baked white enamel finish reflects light for perfect viewing of slides.

Expand 1 Items
Loading...
Acid Red 52, Dr. Ehrenstorfer, LGC Standards

Acid Red 52, Dr. Ehrenstorfer, LGC Standards

Supplier: LGC Standards

Organic Standard, Acid Red 52

Expand 1 Items
Loading...
Fluorescent Viewing Goggles

Fluorescent Viewing Goggles

Supplier: NOIR MEDICAL

Necessary Protection When Operating Forensic Light Source

Expand 1 Items
Loading...

Human Adrenomedullin (1-52)

Supplier: Anaspec

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Adrenomedullin (1-52)

Supplier: Thermo Scientific Chemicals

Adrenomedullin (1-52), human

Expand 1 Items
Loading...
Mighty Scope Dual View Stand, Aven Inc.

Mighty Scope Dual View Stand, Aven Inc.

Supplier: Aven Tools

The Dual View Stand allows users to mount two Mighty Scopes

Expand 1 Items
Loading...

Buffer, Sodium Acetate Buffer Solution pH 5,2 (3 mol/L), ROCK

Supplier: Rockland Immunochemical

3.0 M Sodium Acetate, pH 5.2

Expand 1 Items
Loading...

E alpha (52–68)

Supplier: Anaspec

This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

AED Lifeline and Lifeline View Automated External Defibrillators, Defibtech

Supplier: Defibtech

Defibtech AEDs offer industry-leading innovation, simplicity, and elegance.

Expand 3 Items
Loading...

Human Adrenomedullin (22-52)

Supplier: Anaspec

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...
Anti-p-CK Antibody [clone: CAM 5.2]

Anti-p-CK Antibody [clone: CAM 5.2]

Supplier: Diagnostic Biosystems

Anti-Cytokeratin (CAM 5.2) reagent has a primary reactivity with human keratin proteins that correspond to Moll’s peptides #7 and #8, Mr 48 and 52 kilodaltons (kd), respectively. Cytokeratin 7 and 8 are present on secretory epithelia of normal human tissue but not onstratified squamous epithelium. Anti-Cytokeratin (CAM 5.2) stains most epithelial-derived tissue, including liver, renal tubular epithelium, and hepatocellular and renal cell carcinomas. Anti-Cytokeratin (CAM 5.2) might not react with some squamous cell carcinomas.

Expand 3 Items
Loading...

3M Sodium Acetate, pH 5.2 Solution, Teknova

Supplier: Teknova

pH adjusted to 5.2 with Glacial Acetic acid. Size: 250mL.

Expand 1 Items
Loading...

Human Adrenomedullin (13-52)

Supplier: Thermo Scientific Chemicals

Adrenomedullin (13-52), human

Expand 1 Items
Loading...
SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP

SP Bel-Art View-Pack™ Microscope Slide Holder with Ring Binder, Bel-Art Products, a part of SP

Supplier: Bel-Art Products, a Part of SP

Standard 23x30 cm (9x12") three-ring binder comes complete with ten, 22x27 cm (8½x10½") vinyl View-Pack™ Microscope Slide Holder Pages (enough for 160 slides).

Expand 2 Items
Loading...

Pharmaceutical Standards, Fingolimod Impurity 52

Supplier: TLC Standards

Pharmaceutical Standards, Fingolimod Impurity 52

Expand 3 Items
Loading...

Pharmaceutical Standards, Rivaroxaban Impurity 52

Supplier: TLC Standards

Pharmaceutical Standards, Rivaroxaban Impurity 52

Expand 3 Items
Loading...
Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)

Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)

Supplier: Creative Biomart

Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)

Expand 1 Items
Loading...
Sort By
Recommended for You