Supplier: AAT Bioquest

This compound is used as a calibration standard for CF-MU-based enzyme substrates.

Supplier: DWK Life Sciences (KIMBLE)

Calibrated to contain

Supplier: Ambeed

AR-42 98%, Ambeed.Inc

Supplier: Aladdin Scientific

AR-42 ≥98%

Supplier: Ambeed

6'-(Pyridin-4-yl)-4,2':4',4''-terpyridine, Purity: 97%, CAS Number: 113919-79-2, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100mg

Supplier: Ambeed

4-([4,2':6',4''-Terpyridin]-4'-yl)benzoic acid, Purity: 98%, CAS Number: 1370206-12-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250MG

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051351-500MG , MDL Number: MFCD09965937

Supplier: MEDTEST DX, INC.

DRI THC 50 NG/ML CALIBRATOR

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051372-500MG , MDL Number: MFCD12410390

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051370-500MG , MDL Number: MFCD12169085

Supplier: Matrix Scientific

MF=C12H15N3O MW=217.27 CAS=202826-52-6 MDL=MFCD11049641 5G

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051358-500MG , MDL Number: MFCD12169089

Supplier: Thermo Scientific Chemicals

Bismuth Tin alloy (58:42 w%), eutectic ≥99.95% (metals basis), lumps

Supplier: Matrix Scientific

Matrix Scientific Part Number: 051379-500MG , MDL Number: MFCD13561480

Supplier: Matrix Scientific

1'-Ethyl-6'-Methyl-1'H-Spiro[Piperidine-4, 2'-Quinazolin]-4'(3'H)-One, MF=C15H21N3O, MW=259.35, CAS=1351398-03-2, 500MG

Supplier: Ambeed

Bis(2-methyl-2-propanyl) (2S,2'S)-2,2'-[4,4'-biphenyldiylbis(1H-imidazole-4,2-diyl)]di(1-pyrrolidinecarboxylate), Purity: 95%, CAS Number: 1007882-23-6, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8 deg C, Size: 5g

Supplier: Ambeed

(OC-6-42)-Bis[[2,3-butanedione 2,3-di(oximato-κN)](1-)]chloro(4-methoxypyridine-κN)cobalt ≥97%

Supplier: Anaspec

Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Bachem Americas

The arctic mutant of amyloid β-protein 1-42, in which Glu²² is substituted by Gly, is distinctly more amyloidogenic than the wild-type Aβ 1-42.

Supplier: Bachem Americas

Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.

Supplier: Bachem Americas

Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer's disease and late Down's syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of H-1368 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42 peptide. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.

Supplier: Bachem Americas

GLMVGGVVIA, a partial sequence of β-amyloid protein which is used for raising antibodies against Aβ 1-42. Li et al. studied the aggregation behavior of this and other Aβ 1-42 C-terminal fragments.

Supplier: Anaspec

Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Thermo Scientific Chemicals

b (42-1)

Supplier: Bioss

Protein 4.2; protein4.2; EPB42; EPB42_HUMAN; Erythrocyte membrane protein band 4.2; Erythrocyte protein 4.2; Erythrocyte surface protein band 4.2; MGC116735; P4.2; PA; SPH5.

Supplier: Thermo Scientific Chemicals

b (1-42), hydrochloride

Supplier: Anaspec

This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

This is a salt form of Aβ(1-42) known to form aggregates within a few days in water or recommended solvents. The salt form has been found to form fibrils, exerts cytotoxicity in neuronal models and so, used in studies that evaluate activity of agents that reverse amyloid-induced cytotoxicity.

Supplier: Bachem Americas

All-D Aβ (1-42) exhibits similar properites as the all-L Aβ. The peptide forms ion channels in lipid bilayers.

Supplier: Anaspec

This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C